SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B6ISH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B6ISH1
Domain Number 1 Region: 12-107
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 4.25e-35
Family VPS28 N-terminal domain 0.0017
Further Details:      
 
Domain Number 2 Region: 114-137
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 0.00000458
Family VPS28 C-terminal domain-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B6ISH1
Sequence length 139
Comment (tr|A0A1B6ISH1|A0A1B6ISH1_9HEMI) Uncharacterized protein {ECO:0000313|EMBL:JAS89833.1} OX=320908 OS=Homalodisca liturata. GN=g.20430 OC=Membracoidea; Cicadellidae; Cicadellinae; Homalodisca.
Sequence
MSDSNRPELFEDVKLFRNAREREKYDNMADLYAVINTLQNLEKAYIRDCVTPKEYTAACS
KLLVQYKAAFKQVQGDEFPNIEGFVKKYRLDCPAAMERIKEDRPITIKDDKGNTSKCIAD
IVSLFITLMDKLRLDLKPQ
Download sequence
Identical sequences A0A1B6ISH1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]