SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B6KU36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B6KU36
Domain Number 1 Region: 149-219
Classification Level Classification E-value
Superfamily BEACH domain 4.45e-19
Family BEACH domain 0.002
Further Details:      
 
Domain Number 2 Region: 36-121
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000664
Family Protein kinases, catalytic subunit 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B6KU36
Sequence length 220
Comment (tr|A0A1B6KU36|A0A1B6KU36_9HEMI) Uncharacterized protein {ECO:0000313|EMBL:JAT14959.1} OX=36148 OS=Graphocephala atropunctata. GN=g.49925 OC=Membracoidea; Cicadellidae; Cicadellinae; Cicadellini; Graphocephala.
Sequence
LLREVIDRAYSCPIVPLDGSSGICVPENEKCESPLHPNLLPCIVALESTKYFILVYENVP
GHTLLDCVTFSPAILGTNSKMLFLVYQLLCLLRHIHDLGLVLADITLSDIYVDSHLWIQV
TPKLEANIYELPSKPQSAQTTPSVERTEKSQDINTLTLAWVRGAISNLEYLTALNNLAGR
RYGDPRCHHVLPWVTDFSSPNGANWRDLTKSKFRLNKGDR
Download sequence
Identical sequences A0A1B6KU36

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]