SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B6L6L9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B6L6L9
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily BEACH domain 3.27e-41
Family BEACH domain 0.0000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B6L6L9
Sequence length 187
Comment (tr|A0A1B6L6L9|A0A1B6L6L9_9HEMI) Uncharacterized protein {ECO:0000313|EMBL:JAT19310.1} OX=36148 OS=Graphocephala atropunctata. GN=g.1369 OC=Membracoidea; Cicadellidae; Cicadellinae; Cicadellini; Graphocephala.
Sequence
PKWASTAEDFIYKHRKALESEYVSSHLHEWIDLVFGCKQKGAKAVEALNVFYYCSYEGAV
DLDAITNPVEREAVEGMINNFGQTPSQLLKEPHPARLTLPDALSRMLKTDRKPDITMFLN
KLSPVSVEVSSDKDPVVYLSGPRSPTRGFLQAALPDCLVTVSRAGVLGVHSWLPYDRYNN
RGFTLDV
Download sequence
Identical sequences A0A1B6L6L9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]