SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B7NDT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B7NDT8
Domain Number 1 Region: 5-65
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.0000000000000562
Family Preprotein translocase SecE subunit 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B7NDT8
Sequence length 70
Comment (tr|A0A1B7NDT8|A0A1B7NDT8_9HOMO) SecE/sec61-gamma protein {ECO:0000313|EMBL:OAX43033.1} KW=Complete proteome; Reference proteome OX=1314800 OS=Rhizopogon vinicolor AM-OR11-026. GN=K503DRAFT_862608 OC=Rhizopogonaceae; Rhizopogon.
Sequence
MSEKLQEFIDIPQQFVRDGNQFLTRCTKPSQKEFIQICKAVSVGFAVMGFIGYFVKLIHI
PINNILVGGA
Download sequence
Identical sequences A0A1B7NDT8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]