SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B7P0U4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B7P0U4
Domain Number 1 Region: 102-177
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 4.71e-31
Family Skp1 dimerisation domain-like 0.0000274
Further Details:      
 
Domain Number 2 Region: 33-86
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000722
Family BTB/POZ domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B7P0U4
Sequence length 199
Comment (tr|A0A1B7P0U4|A0A1B7P0U4_9EURO) E3 ubiquitin ligase complex SCF subunit sconC {ECO:0000313|EMBL:OAX82487.1} KW=Complete proteome; Reference proteome OX=1658172 OS=Emmonsia sp. CAC-2015a. GN=ACJ72_03157 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Emmonsia.
Sequence
MSPPAKDDANASSAGKNEVRLIPSDEPQGGPGISVERSIIERSILIKNMLEDVGGSIEDE
IPIPNVNRAVLEKVIAWCTKHQGDPPSTGDEDNDSRRKTTDIDEWDQKFMQVDQEMLFEI
ILAANYLDIKALLDIGCKTVANMIKGKSPEDIRKTFNIQNDFTPEEEAQIRAENEWAEEY
VSFTLISTHSSTPPCCTVF
Download sequence
Identical sequences A0A1B7P0U4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]