SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B7T8C6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B7T8C6
Domain Number 1 Region: 2-160
Classification Level Classification E-value
Superfamily Arp2/3 complex 16 kDa subunit ARPC5 6.93e-23
Family Arp2/3 complex 16 kDa subunit ARPC5 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B7T8C6
Sequence length 160
Comment (tr|A0A1B7T8C6|A0A1B7T8C6_9ASCO) Actin-related protein 2/3 complex subunit 5 {ECO:0000256|RuleBase:RU004301} KW=Complete proteome; Reference proteome OX=766949 OS=Hanseniaspora valbyensis NRRL Y-1626. GN=HANVADRAFT_54202 OC=Saccharomycetes; Saccharomycetales; Saccharomycodaceae; Hanseniaspora.
Sequence
MEDWRKIDIDSLDSSTRNKRLTQDSILNNFIEKGIIHTYSSEELNNLIGELSGRISKNDF
SSSLLDIVVKYPVYASQDPELKLKYLQLVNNCLVNLKDIDSIMKQLSQDDADLLLKYCYK
IMSLKQFQANGQLIINWVDKIIIKYGQGAVLRYITDRKTI
Download sequence
Identical sequences A0A1B7T8C6
jgi|Hanva1_1|54202|fgenesh1_kg.311_#_1_#_Locus1630v1rpkm102.62

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]