SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B7W6Y2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B7W6Y2
Domain Number 1 Region: 45-213,279-298
Classification Level Classification E-value
Superfamily Cytochrome f, large domain 1.83e-91
Family Cytochrome f, large domain 0.0000000273
Further Details:      
 
Domain Number 2 Region: 214-279
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 3.45e-17
Family Cytochrome f, small domain 0.00011
Further Details:      
 
Domain Number 3 Region: 296-333
Classification Level Classification E-value
Superfamily Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00000000000000222
Family Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B7W6Y2
Sequence length 333
Comment (tr|A0A1B7W6Y2|A0A1B7W6Y2_9NOST) Cytochrome f {ECO:0000256|HAMAP-Rule:MF_00610} KW=Complete proteome OX=1710886 OS=Anabaena sp. MDT14b. GN=AN485_20175 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MRNALTPARLTRTAKAMVNTLLIAIATVTFFFTSDIAVPQTAAAYPFWAQETAPATPREA
TGRIVCANCHLAAKPTEVEIPQSVLPDTVFKAVVKIPYDATVQQVGADGSKVGLNVGAVL
MLPQGFKIAPEDRISEELKAEVGDMTFTPYNDSTDNVVIVGPLPGEEYQEIVFPILSPNP
ATDKNIHFGKYSVHVGGNRGRGQVYPTGEKSNNNAFNASAAGTISKIAKTEDEDGNVKNL
ISITTATGDVVTDTVPAGPELIVTEGQVVAISDALTNNPNVGGFGQKDAEIVLQDSSRVT
WLVAFICLVMLAQVMLVLKKKQVEKVQAAEMNF
Download sequence
Identical sequences A0A1B7W6Y2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]