SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B8FZ65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B8FZ65
Domain Number 1 Region: 85-200
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 3.14e-35
Family Frataxin-like 0.0000612
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B8FZ65
Sequence length 207
Comment (tr|A0A1B8FZ65|A0A1B8FZ65_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:OBT88882.1} KW=Complete proteome OX=1622148 OS=Pseudogymnoascus sp. 03VT05. GN=VE02_01886 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MSRVNIFRIFRLANRNVPLTSQRCQVPGARALSTKAILPIAVANKSYIPGSVRNFSCSQA
SPKGIYPETENPPAKTLEPEAKPQEPTELTIEEYHEAADTCIDSLVATFEELQEAREDVD
VEYSAGVLTLIFPPIGTYVINKQPPNKQIWLSSPISGPKRYDWVVSGEAQNQKEGGGQGR
WVYIRDGSTLNEMLEKEVGVDLTEVID
Download sequence
Identical sequences A0A1B8FZ65

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]