SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B8GNH7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B8GNH7
Domain Number 1 Region: 88-163
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.66e-31
Family Skp1 dimerisation domain-like 0.0000303
Further Details:      
 
Domain Number 2 Region: 8-72
Classification Level Classification E-value
Superfamily POZ domain 3.66e-20
Family BTB/POZ domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B8GNH7
Sequence length 166
Comment (tr|A0A1B8GNH7|A0A1B8GNH7_9PEZI) E3 ubiquitin ligase complex SCF subunit sconC {ECO:0000313|EMBL:OBT97356.1} KW=Complete proteome; Reference proteome OX=342668 OS=Pseudogymnoascus verrucosus. GN=VE01_04353 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MADQGPNTITLISNDGVPIVVKRQVAERSMLIVNMMEDLGETAGAEVPIPNVNESVLKKV
IEWCEHHKDDPPASADDDSDSRKKTTDIEEWDQKFMQVDQEMLFEIILASNYLDIKPLLD
VGCKTVANMIKGKSPEEIRKTFNITNDFTPEEEDQIRRENEWAEDR
Download sequence
Identical sequences A0A094EYW2 A0A094GZG5 A0A1B8F5D2 A0A1B8FF18 A0A1B8GNH7
XP_018131089.1.55463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]