SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B8Y8M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B8Y8M3
Domain Number 1 Region: 13-86
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 0.00000000000183
Family Interleukin 8-like chemokines 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B8Y8M3
Sequence length 100
Comment (tr|A0A1B8Y8M3|A0A1B8Y8M3_XENTR) Uncharacterized protein {ECO:0000313|EMBL:OCA19349.1} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=XENTR_v90029261mg OC=Silurana.
Sequence
mdskyaiiilcvlilsaaliegqgtkgrrclckkmskklspkrlikieiypagyrcenie
yvatmkgskktkcfspnskllkeimspkgklqsikiikhe
Download sequence
Identical sequences A0A1B8Y8M3
gi|301622608|gb|XP_002940624| XP_002940624.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]