SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B8YDS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B8YDS9
Domain Number 1 Region: 8-134
Classification Level Classification E-value
Superfamily Actin-crosslinking proteins 1.06e-16
Family Fascin 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B8YDS9
Sequence length 137
Comment (tr|A0A1B8YDS9|A0A1B8YDS9_PHOLU) Uncharacterized protein {ECO:0000313|EMBL:OCA53276.1} KW=Complete proteome OX=29488 OS=Photorhabdus luminescens (Xenorhabdus luminescens). GN=Phpb_03761 OC=Morganellaceae; Photorhabdus.
Sequence
MGLSSSPIALQADNGFYLSRIDRGGGFDFIEANKSIIDIYTKYSATQLSSNKIALRASNG
LYLSRISLAGSDYIVATKSDIDIYSTFTLEYIDDNVVALCADNGKYLSRINAGGIFNYIK
PDKYDLDIYCQFKVINL
Download sequence
Identical sequences A0A1B8YDS9
WP_065391669.1.8768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]