SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1B9GZM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B9GZM6
Domain Number 1 Region: 11-289
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.49e-74
Family Capz beta-1 subunit 0.000000255
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B9GZM6
Sequence length 304
Comment (tr|A0A1B9GZM6|A0A1B9GZM6_9TREE) Capping protein (Actin filament) muscle Z-line, beta {ECO:0000313|EMBL:OCF36470.1} KW=Complete proteome; Reference proteome OX=1296120 OS=Kwoniella heveanensis BCC8398. GN=I316_01719 OC=Tremellomycetes; Tremellales; Cryptococcaceae; Kwoniella.
Sequence
MVCNARDIVTFDSLLDLLRRLPPTKVEENVNALCDIVPDYADDLLGNVDQPLKVLNDAEK
GREFLGCDYNRDGDAFRSPWTNNYLPEATGGPTPSPRLRQLEVSLNAAFDTYREMYFEGG
ISSVYLWDLEDDPGEGKEMSFAGVVLLKKTLSTPSANAPEGTPQGSWDSLHVFECHERGR
SAKYKLTSTVMLVLETKTLARADIKGLSGTDTDGVEGKGGVTLSGSMTRQAEVDYPLTSA
AGHIPNIGRIVEDMEIKMRNLLSSVYFGKTKDVINDLRSQSGLEAKSKEDMLRAELAGKL
GARK
Download sequence
Identical sequences A0A1B9GZM6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]