SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1B9IK13 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B9IK13
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.35e-73
Family Capz beta-1 subunit 0.000000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B9IK13
Sequence length 299
Comment (tr|A0A1B9IK13|A0A1B9IK13_9TREE) Capping protein (Actin filament) muscle Z-line, beta {ECO:0000313|EMBL:OCF55813.1} KW=Complete proteome; Reference proteome OX=1331196 OS=Kwoniella mangroviensis CBS 10435. GN=L486_06566 OC=Tremellomycetes; Tremellales; Cryptococcaceae; Kwoniella.
Sequence
MAEADLTFDSLLDLLRRLPPTRVEENVNALCDLAPEYTDDLLGNVDQPLKVLTDGEKGRE
FLGCDYNRDGDSFRSSWSNDYLPTSTGGPVPSSRLRELEVSLNAAFDTYREMYFEGGISS
VYLWDLEDDPGQGKEISFAGVVLMKKVLSTPTSDQPETTPSGSWDSLHVFECQERGRSAK
YKLTSTVMLVLETKTLAKAELKGVDESESKGKGGVTLSGSMTRQAEVDYPLTNSAGHIPN
IGRMVEDMEIKMRNLLSSVYFGKTKDVINELRSQSGLEMKSKEDLLRAELAGKLGGRRA
Download sequence
Identical sequences A0A1B9IK13
XP_019002126.1.25069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]