SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B9KDE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B9KDE6
Domain Number 1 Region: 5-69
Classification Level Classification E-value
Superfamily N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.0000000000000562
Family N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B9KDE6
Sequence length 186
Comment (tr|A0A1B9KDE6|A0A1B9KDE6_9GAMM) Sigma-E factor negative regulatory protein {ECO:0000256|PIRNR:PIRNR016938} KW=Complete proteome OX=1196095 OS=Gilliamella apicola. GN=A9G13_03490 OC=Gilliamella.
Sequence
MQKEQKEQLSSLMDGEFTDDHIINDISNDESLRLCWHRYHIVRGALRGELHNSALTLDVS
NQVAQAIANDNLYNQLDEQPVPHKTIIPKVGNLLWVRMKDVMTHLSQVGLAACVTLAIIA
GVQYHQDQTKEVNGVPTLNTVPVGVNVAPVGGVQQKNDQQLLEKRQYDKIKLLVQDYELQ
KRLNAH
Download sequence
Identical sequences A0A1B9KDE6
WP_065556280.1.1805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]