SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B9L920 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B9L920
Domain Number 1 Region: 6-170
Classification Level Classification E-value
Superfamily MtlR-like 1.57e-39
Family MtlR-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B9L920
Sequence length 183
Comment (tr|A0A1B9L920|A0A1B9L920_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:OCG21467.1} KW=Complete proteome OX=1196095 OS=Gilliamella apicola. GN=A9G22_09605 OC=Gilliamella.
Sequence
MPESILQEDTILEKLNQQADIHSLLTVAIKLINDNVNKLILKVFRKEPHAIKFVIPSLVG
KNGPLNDTSVCLKLLYVLGIISREDYEDIELLIAILDELEQDDRQYTYLDDEILGPISLL
HDMVLPPSWESQHEKAKQSGIVDTLKSSMYQNRYQQMIRSALIIAITDLTLRIINKEHIN
YFP
Download sequence
Identical sequences A0A1B9L920
WP_065586010.1.31277 WP_065586010.1.66427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]