SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C0TYW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C0TYW4
Domain Number 1 Region: 28-135
Classification Level Classification E-value
Superfamily DNA polymerase III psi subunit 1.7e-34
Family DNA polymerase III psi subunit 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1C0TYW4
Sequence length 137
Comment (tr|A0A1C0TYW4|A0A1C0TYW4_9GAMM) DNA polymerase III subunit psi {ECO:0000256|PIRNR:PIRNR029225} KW=Complete proteome OX=286156 OS=Photorhabdus asymbiotica subsp. australis. GN=Ppb6_03961 OC=Morganellaceae; Photorhabdus.
Sequence
MVTRRDRLLAQLGITQWTLRNPAVLQGELAVHLPDATRLLIITNDHIDLTNSLLIDIFTA
MGLDKSSVYCITSDNVAMLPEQVKCPCWLLGVDITLSWQGISLRSPALNDLYFDGQAKRS
LWQQISQYEQHFSINSR
Download sequence
Identical sequences A0A1C0TYW4
WP_065824518.1.84120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]