SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1C0UT21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1C0UT21
Domain Number - Region: 65-204
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00366
Family Capz alpha-1 subunit 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1C0UT21
Sequence length 438
Comment (tr|A0A1C0UT21|A0A1C0UT21_STREE) 3-isopropylmalate dehydrogenase {ECO:0000313|EMBL:OCQ85261.1} KW=Complete proteome OX=1313 OS=Streptococcus pneumoniae. GN=A4260_02615 OC=Streptococcus.
Sequence
MRITDNQHKIIKEKFVEEYPKLSNLLLDRTLESLSQDERIFIFPNDLTHTPDLDKDQKIF
ETVNQKIKTGNVIGFLGYGQERLTISSRFSDESNDHFLHYLLNKVLHINLTSLDVALSRE
ERLYQLLVYLFPKYLQAAIRKGLYKEYHRFSHNDSNVKGVIDVRSHLKKNLPFTGNIAYA
TREFTYDNPLMQLVRHTIEYIKNQKSIGQGVLDNLSTSRENVSEIVRVTPSYKLADRAKI
IRGNQSKPIRHAYFHEYRNLQELCLMILNQEKHGLGYQDQKIYGILFDVAWLWEEYVYTL
LPKGFVHPRNKDKTDGISVFSVGKRKVYPDFYDRERKIVLDAKYKKLELTEKGINREDLF
QLISYSYILKAEKAGLIFPSMEQSVNSEIGKVAGYGAQLKKWSIRIPQNASFYSTFCKMM
ENSEENFKAIIDEEVGRK
Download sequence
Identical sequences A0A1C0UT21

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]