SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C3EMG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C3EMG6
Domain Number 1 Region: 32-103
Classification Level Classification E-value
Superfamily Barstar-related 0.0000000000432
Family Barstar-related 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1C3EMG6
Sequence length 135
Comment (tr|A0A1C3EMG6|A0A1C3EMG6_9PLAN) Uncharacterized protein {ECO:0000313|EMBL:ODA34443.1} KW=Complete proteome OX=1841610 OS=Planctopirus sp. JC280. GN=A6X21_17450 OC=Planctomycetaceae; Planctopirus.
Sequence
MSSANHPYALCFEPLSPAQNATGVLEVTIPARISSKQTLLEIYSRQLGCPWFGHNWDALA
DALNDLSWLHYRPVVIRHDDLPFGPGRRSRSLYLDLLAEAVSRWQVDDPGRLRVLFPEAD
LAGLCSLAPRSDQSQ
Download sequence
Identical sequences A0A1C3EMG6
WP_068846648.1.17294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]