SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1C3KTF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C3KTF0
Domain Number 1 Region: 4-299
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.92e-66
Family Capz alpha-1 subunit 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1C3KTF0
Sequence length 308
Comment (tr|A0A1C3KTF0|A0A1C3KTF0_9APIC) F-actin-capping protein subunit alpha, putative {ECO:0000313|EMBL:SBT77386.1} OX=36330 OS=Plasmodium ovale (malaria parasite P. ovale). GN=POWCR01_100008400 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MDSSLNEKKKFIRHVILNAPPGKLPDLVSNLKVLFGSTTIINNFFEEVVSNYNEKNYAMV
PITEDDYVITCEQSKNENLYLNPQLKLLVTVNHLKRKVTATTSLQEVKHSLLLENYRHVC
SEKLKEYVESHYTRWNEVQTLNYPTVNLKSKNGLNVKCSSSVYATEQEDKFNLFFIICCD
RFYLKNFHASSWRSSWEVNFLMNHQEALLMGTIDIILTYFEDANINFKTTVKFEEKVNVD
NEIEAFSTNILSAIRACENNVLYDLNNFMINTSKSLIKNARKIIPLNGDKFYWKETYQNI
PSHIRLIQ
Download sequence
Identical sequences A0A1C3KTF0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]