SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C3NW58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C3NW58
Domain Number 1 Region: 46-139
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.00000126
Family Crystallins/Ca-binding development proteins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1C3NW58
Sequence length 143
Comment (tr|A0A1C3NW58|A0A1C3NW58_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:SBW20479.1} KW=Complete proteome; Reference proteome OX=1839754 OS=Candidatus Frankia californiensis. GN=FDG2_1707 OC=Bacteria; Actinobacteria; Frankiales; Frankiaceae; Frankia.
Sequence
MDRAHRTHGTADQTRRRSWRRRTAGVGVATALALSAGGVGMASAAQAADGYFRVWEHNGA
GGAGCAWFGDDADYRYNTDCGNFNDRVSSLKNDGYPGAFEDVQIFEDINYRGASICVPNG
AYWSSMPAGWNDRVSSHKWVNAC
Download sequence
Identical sequences A0A1C3NW58

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]