SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C7F7P5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C7F7P5
Domain Number 1 Region: 8-71
Classification Level Classification E-value
Superfamily N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 1.57e-19
Family N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1C7F7P5
Sequence length 210
Comment (tr|A0A1C7F7P5|A0A1C7F7P5_9VIBR) Sigma-E factor negative regulatory protein {ECO:0000256|PIRNR:PIRNR016938} KW=Complete proteome OX=45658 OS=Vibrio scophthalmi. GN=VSF3289_00530 OC=Vibrionaceae; Vibrio.
Sequence
MVKIMADKEKLSALMDGELVDKALIAELENDQAGLDAWKNYHLIGDVLRGDAPHKPEWNI
AESVALALENEPAHRQLDAHNVTSIDEARIESQPAPHQAKRNLPAWITQFGQVGIAACVS
LAVILGVQQTGGDVETGTDPLPVLQTIPFSGSVEPVSLTRDSVEQAPKNGVNVQEQRRRI
NAMLQDYELQLRLNSESSMDRNDHPDTVVE
Download sequence
Identical sequences A0A1C7F7P5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]