SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1C7M0T7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C7M0T7
Domain Number 1 Region: 6-244
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.67e-65
Family Capz alpha-1 subunit 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1C7M0T7
Sequence length 257
Comment (tr|A0A1C7M0T7|A0A1C7M0T7_GRIFR) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:OBZ68734.1} KW=Complete proteome; Reference proteome OX=5627 OS=Grifola frondosa (Maitake) (Polyporus frondosus). GN=A0H81_11076 OC=Agaricomycetes; Polyporales; Grifolaceae; Grifola.
Sequence
MNPAGRIQAASKFLLQSPPGEINDVLNDVRNIISDDDSLQTGVLPALREYNLAQFITADV
PGHQHQETSDAEHVEPDEESEAFRSALETASLSYLSAHYHDGVTSIFPSPGSSTSFIVQI
VANKYNPSNFWSGRWRSEYVIDLDAKQIQGKIFLSVHYYEQGNVQLSTSHIISLALPPAI
TAPGGASSASKVLALIEAEEGKYQASLNDVYAEMGEKTFKGLRRALPMTRSKLDWDKVLG
YKLGAELTSSKGVFGTS
Download sequence
Identical sequences A0A1C7M0T7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]