SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C9CFE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C9CFE0
Domain Number 1 Region: 32-199,261-280
Classification Level Classification E-value
Superfamily Cytochrome f, large domain 2.22e-89
Family Cytochrome f, large domain 0.000000254
Further Details:      
 
Domain Number 2 Region: 277-315
Classification Level Classification E-value
Superfamily Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.0000000000000628
Family Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00094
Further Details:      
 
Domain Number 3 Region: 200-261
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 0.00000000000753
Family Cytochrome f, small domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1C9CFE0
Sequence length 315
Comment (tr|A0A1C9CFE0|A0A1C9CFE0_9FLOR) Cytochrome f {ECO:0000256|HAMAP-Rule:MF_00610} OX=135206 OS=Hildenbrandia rivularis. GN=Hrvl_025 OC=Hildenbrandiales; Hildenbrandiaceae; Hildenbrandia.
Sequence
MKLNRSIKFAFLALALPGIFFNTVNLTKCHGFPIYAQQSYDNPREATGRIVCANCHLAQK
PVTIEVPQAVLPNSTFEAIVKIPYDNQQKQILGNGMKGELNIGGIVILPEGFKLAPKHKT
SKATQLKNKGIYIQPYSKAKDNILVVGPIPGNSHQEIIFPIIAPDPAQNKNVHFLKYSIY
VGGNRGRGQIYPSGDKSNNNAITATIDGQVHKIETLNNGGLVVEIKDTNGDIKTAQIPSS
LDLRVHLGDVVKQDEALTSDPNIGGFGQSETEIVLQNPKRIQGMIVFFLILTVAQIFFIL
KKKQFEKVQALERNF
Download sequence
Identical sequences A0A1C9CFE0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]