SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D0C3C9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D0C3C9
Domain Number 1 Region: 36-203,266-285
Classification Level Classification E-value
Superfamily Cytochrome f, large domain 4.32e-96
Family Cytochrome f, large domain 0.0000000143
Further Details:      
 
Domain Number 2 Region: 203-265
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 6.28e-20
Family Cytochrome f, small domain 0.0000694
Further Details:      
 
Domain Number 3 Region: 282-320
Classification Level Classification E-value
Superfamily Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 9.81e-16
Family Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1D0C3C9
Sequence length 320
Comment (tr|A0A1D0C3C9|A0A1D0C3C9_9FABA) Cytochrome f {ECO:0000256|HAMAP-Rule:MF_00610} OX=1378388 OS=Acacia merrallii. GN=petA OC=mimosoid clade; Acacieae; Acacia.
Sequence
MQTRNYCSWIKEEITRSISVSLMIYIITRAPISNAYPIFAQQGYENPREATGRIVCANCH
LANKPVDIEVPQAVLPDTVFEAVVRIPYDMQVKQVLANGKKGALNVGAVLILPEGFELAP
PDRISPEIKEKIGNLSFQSYRPTKKNILVVGPVPGQKYNEITFPILSPDPATKRDVHFLK
YPIYVGGNRGRGQLYPDGSKSNNNVYNATAAGIVNKIIRKEKGGYEITIVDASDGREVID
IIPPGPEPLVSEGESIKLDQPLTSNPNVGGFGQGDAEIVLQDPLRVQGLLFFVASVILAQ
IFLVLKKKQFEKVQLSEMNF
Download sequence
Identical sequences A0A1D0BS59 A0A1D0BT90 A0A1D0BUU3 A0A1D0BX13 A0A1D0BXP9 A0A1D0BY87 A0A1D0BZ29 A0A1D0C1T0 A0A1D0C1X4 A0A1D0C2W1 A0A1D0C3C9 A0A1D0C478 A0A1D0C498 A0A1D0C4H2 A0A1D0C4J7 A0A1D0C5P1 A0A1D0C694 A0A1D0C7L7 A0A1D0C7Y0 A0A1D0C880 A0A1D0C9U5 A0A1D0CA27 A0A1D0CA35 A0A1D0CBD8 A0A1D0CBV8 A0A1D0CDF5 A0A1D0CFL6 A0A1D0CFR8 A0A1D0CKM3 A0A1D0CNN9 A0A1D0CNP4 A0A1D0CQB6 A0A1D0CQN1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]