SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1D2VNC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D2VNC1
Domain Number 1 Region: 43-167,227-354
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.49e-53
Family Capz alpha-1 subunit 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1D2VNC1
Sequence length 365
Comment (tr|A0A1D2VNC1|A0A1D2VNC1_9ASCO) Subunits of heterodimeric actin filament capping protein Capz {ECO:0000313|EMBL:ODV63100.1} KW=Complete proteome; Reference proteome OX=1344418 OS=Ascoidea rubescens DSM 1968. GN=ASCRUDRAFT_74493 OC=Saccharomycetes; Saccharomycetales; Ascoideaceae; Ascoidea.
Sequence
MRLIAAVAFPSQKQRQQKQQKQQRKRSNNSNRSTITMADDFQIISDDFINDAPPGETANV
VNDLAAIVDNKDITSQLHQSILASILSSSSINFKIIFYSGSNLILSKFNYDETTNQFFDY
NINKSFDVNLISNRILNVDNNLSSTLPYDLKNLNKSLASYINQHYPSVVKKNMAYAIFPI
DNDHSYTQLFDKEFNNQFSKEFENTPVPRNNTITDDLTDGNDDESNENDLNIHQDADHYD
KFIIIILNNKFNPSNFWNGSWSSYYVYSNSMQKLFGKISIDIHYYEDGNVRLKTFKTLNQ
SNVSKINIINSINAFENNFQNFLSLKFLKLNQNGFKSLRRQLPVTRSKIQWGKGYALGKS
VVIND
Download sequence
Identical sequences A0A1D2VNC1
XP_020049407.1.61322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]