SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D2WUY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1D2WUY9
Domain Number - Region: 29-50
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 0.0672
Family Bcl-2 inhibitors of programmed cell death 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1D2WUY9
Sequence length 62
Comment (tr|A0A1D2WUY9|A0A1D2WUY9_9EURY) Uncharacterized protein {ECO:0000313|EMBL:OED05152.1} KW=Complete proteome OX=1860156 OS=Methanobrevibacter sp. A54. GN=A9757_03330 OC=Methanobacteriaceae; Methanobrevibacter.
Sequence
MSVVEFNFDIAVSTLIAVIIAVYYKRRYGDEIFKDKRTWVKILVLFFVANLIKVLIKPLI
GF
Download sequence
Identical sequences A0A1D2WUY9 A5UKY5
420247.Msm_0658 gi|148642718|ref|YP_001273231.1| WP_011954029.1.44750 WP_011954029.1.59899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]