SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D3DGV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D3DGV6
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Barstar-related 8.37e-22
Family Barstar-related 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1D3DGV6
Sequence length 92
Comment (tr|A0A1D3DGV6|A0A1D3DGV6_9ENTR) Ribonuclease inhibitor {ECO:0000313|EMBL:OEI93811.1} OX=1898038 OS=Shigella sp. FC1655. GN=BHE86_04040 OC=Enterobacteriaceae; Shigella.
Sequence
MKQVIFDFKRLVDRDAFYHDFALQFQLDDKFGDNLDALWDVLMGGIALPVSIVFKHFPHH
SRDFQPLVQLMQEAENELGKDVLSFHCEHTTK
Download sequence
Identical sequences A0A1D2PZY9 A0A1D3DGV6 A0A1E5N5B0
WP_069368718.1.37061 WP_069368718.1.52188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]