SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D3L2U5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D3L2U5
Domain Number 1 Region: 28-140
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.0000192
Family HEPN domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1D3L2U5
Sequence length 142
Comment (tr|A0A1D3L2U5|A0A1D3L2U5_9EURY) Uncharacterized protein {ECO:0000313|EMBL:SCG85873.1} KW=Complete proteome; Reference proteome OX=118062 OS=Methanobacterium congolense. GN=MCBB_1315 OC=Methanobacteriaceae; Methanobacterium.
Sequence
MKFQFEKCKERGKIVKMGKDPELVRKELKESSHDLDSAQKSLSKEDYKWTIVQCYYSMFH
AFRALLFSRGYREKSHIYLKFAIETLFVDEGILNRDLLDNFDFAMRSRERADYSYTYNLN
LAEDLLDSSRELLDEVENLVSQ
Download sequence
Identical sequences A0A1D3L2U5
WP_071906987.1.80384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]