SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D5P514 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D5P514
Domain Number 1 Region: 1-143
Classification Level Classification E-value
Superfamily TIMP-like 7.65e-58
Family Tissue inhibitor of metalloproteinases, TIMP 0.0000026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1D5P514
Sequence length 155
Comment (tr|A0A1D5P514|A0A1D5P514_CHICK) TIMP metallopeptidase inhibitor 4 {ECO:0000313|Ensembl:ENSGALP00000047778} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=TIMP4 OC=Phasianidae; Phasianinae; Gallus.
Sequence
MIRYEIKQIKMFKGFEKLKDVQYVYTPFDSSLCGVKLEANNKKQYLLTGQILNDGKVLIH
LCNYIEPWDDLSLSQKKSLNQRYQMGCGCKITTCYMVPCSITAPNECLWTDWLIERKLYG
HQAKHYACIKRSDGTCSWYRGGPPPEKEFIDISEP
Download sequence
Identical sequences A0A1D5P514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]