SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D5Q8D7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D5Q8D7
Domain Number 1 Region: 76-200
Classification Level Classification E-value
Superfamily Stathmin 1.57e-53
Family Stathmin 0.000000361
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1D5Q8D7
Sequence length 203
Comment (tr|A0A1D5Q8D7|A0A1D5Q8D7_MACMU) Stathmin 4 {ECO:0000313|Ensembl:ENSMMUP00000044305} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=STMN4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MTLAAYKEKMKELPLVSLFCSCFLADPLNKSSYKYEGWCGRQCRRKDESQRKDSADWRER
RAQADTVDLNWCVISDMEVIELNKCTSGQSFEVILKPPSFDGVPEFNASLPRRRDPSLEE
IQKKLEAAEERRKYQEAELLKHLAEKREHEREVIQKAIEENNNFIKMAKEKLAQKMESNK
ENREAHLAAMLERLQEKEPPAAR
Download sequence
Identical sequences A0A096N8M9 A0A1D5Q8D7 A0A2I3T544 A0A2K5CCJ7 A0A2K5H9G8 A0A2K5L476 A0A2K5QEJ0 A0A2K5V083 A0A2K5ZH38 A0A2K6M6G5 A0A2K6RD90 A0A2K6TRJ2 G3SAS9 H2PPW3
ENSP00000428428 ENSPPYP00000020689 ENSP00000428428 ENSPANP00000008960 NP_001269982.1.87134 NP_001269982.1.92137 XP_003937250.1.74449 XP_004046865.1.27298 XP_005562953.1.63531 XP_007960175.1.81039 XP_010376429.1.97406 XP_011740178.1.29376 XP_011799992.1.43180 XP_011839251.1.47321 XP_011901067.1.92194 XP_012290589.1.9421 XP_015000500.1.72884 XP_016814749.1.37143 XP_017395888.1.71028 XP_017740739.1.44346 ENSPPYP00000020689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]