SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D5R2M1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D5R2M1
Domain Number 1 Region: 2-49
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.58e-22
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1D5R2M1
Sequence length 109
Comment (tr|A0A1D5R2M1|A0A1D5R2M1_MACMU) Zinc finger protein 721 {ECO:0000313|Ensembl:ENSMMUP00000054556} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=ZNF721 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MEPLTFRDVAIEFSPEEWKCLDPAQQNLYRDVMLENYRNLVSLAVCSYFTQDFLPVQGIE
DSFHKCILRRYEKFSSLFSSCHVISHRLSRGRNRDAEKNDLLTTEEPVV
Download sequence
Identical sequences A0A1D5R2M1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]