SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1D5RF66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D5RF66
Domain Number 1 Region: 691-837
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-40
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1017-1116
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.65e-30
Family Ras-binding domain, RBD 0.00083
Further Details:      
 
Domain Number 3 Region: 215-372
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-22
Family Phosphotyrosine-binding domain (PTB) 0.013
Further Details:      
 
Domain Number 4 Region: 9-100
Classification Level Classification E-value
Superfamily PDZ domain-like 4.26e-20
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 962-1031
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000207
Family Ras-binding domain, RBD 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1D5RF66
Sequence length 1376
Comment (tr|A0A1D5RF66|A0A1D5RF66_MACMU) Regulator of G protein signaling 12 {ECO:0000313|Ensembl:ENSMMUP00000058960} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=RGS12 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MFRVGEASKRPLPGPTPPRVRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRA
GDQIFAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGIGRLESCSSDEEGGLYEGKGWL
KPKLDSKALGINRAERVVEEMQSGGIFNMIFENPSLCASSSEPLKLKQRSLSESAAARFD
VGHESMNNPNPNMLSKEEISKVIHDDSVFSIGLESHDDFALDASILNVAMIVGYLGSIEL
PSTSSNLESDSLQAIRGCMRRLRAEQKIHSLVTMKIMHDCVQLSTDKAGVVAEYPAEKLA
FSAVCPDDRRFFGLVTMQTNDDGSLAQEEEGALRTSCHVFMVDPDLFNHKIHQGIARRFG
FECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSS
NSDSGIGNFHQEEKSNRVLVVDLGGSSSRHGPGGSAWDGVGGRGTQPWGASWSGPFCPDS
EGSPPFEAAHQTDRFRDLNKHLGPASPVEVPPASLRSSVPPSKRGTVGTSCGFNQRWLPV
HVLREWQCGHASDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVEGSFAQPPLSTPKR
EWSRKAFGMQNIFGPHRTVRKTKEDKKGSKFGRGIGLTQPSQRTSARRSFGRSKRFSITR
SLDDLESATVSDGELTGADLKDCISNNSLSSNASLPSVQSCRRLRERRVASWAVSFERLL
QDPVGVRYFSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATT
PVNIDSQAQLADDVLRAPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRA
LPDSQQVPSSPASKHSLGSDQSSVSTPKKLSGKSKSGRSLNEEMGDEDSEKKRKGAFFSW
SRTRSTGRSQKKREHGDHADDPLHANGGLCRRESQGSVSSAGSLDLSEACRTLAPEKDKA
TKHCCIHLPDGTSCVVAVKAGFSIKDILSGLCERHGINGAAADLFLVGGDKPLVLHQDSS
ILESRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLDLSGLLVRLSG
EKEPLDLGAPISSLDGQRVVLEEKDPSRGKASTDKQKGVPVKQNIAVNSSSRNHSATGEE
RTLGKSNSIKIKGENGKNARDPRLSKREESIAKIGKKKYQKINLDEAEEFFELISKAQSN
RADDQRGLLRKEDLVLPEFLRLPPGSTELTLPTAAAMAKGFSKRSATGNGRESASQPSEQ
WEPAQESSDSPSTSPGSVPSPPGPPGTTPTGQKSPSGPFYTPQSPVSLAQEGTTQIWKRQ
SREVEAGGIQTVEDEHVAELTLMGEGDISSPNSTLLPPPSGPQDVPGPSRPGTSRF
Download sequence
Identical sequences A0A1D5RF66

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]