SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1D5TLS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D5TLS3
Domain Number 1 Region: 12-295
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.46e-84
Family Capz alpha-1 subunit 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1D5TLS3
Sequence length 312
Comment (tr|A0A1D5TLS3|A0A1D5TLS3_WHEAT) Uncharacterized protein {ECO:0000313|EnsemblPlants:TRIAE_CS42_2AS_TGACv1_112889_AA0346820.2} KW=Complete proteome; Reference proteome OX=4565 OS=Triticum aestivum (Wheat). GN= OC=Pooideae; Triticodae; Triticeae; Triticinae; Triticum.
Sequence
MSDDGGAGEPLSGDQKREIAVWFLANAPTGEIHYVAKDVRALLGDDAAYEAAAAEAYPEY
NKTHLVSLELPDRSGDIIITTYGEIDRNNYLDPRTAQIATVDHVKQTCTKLRPATDEELP
SGYIEEFRSAIDYEVSKYVGEAYPKGVSAVYCTNGKDLEEPGADFGLAVVISAARRSPRN
FCNGSWRSIWTLEFSYAFQLVEIKGKIQVDAHYFEEGNVQLDTDVDRKDSTIMQSPEDTA
HTVANIIRHHESEYFSSLEESYLNLSDATFKDLRRKLPVTRTLFPWHNTHAITLTRDLAK
ELGIGKGSHVTR
Download sequence
Identical sequences A0A1D5TLS3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]