SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D6CHF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D6CHF7
Domain Number 1 Region: 64-82,114-272
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 3.27e-64
Family Substrate-binding domain of HMG-CoA reductase 0.00000142
Further Details:      
 
Domain Number 2 Region: 1-116
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 1.83e-46
Family NAD-binding domain of HMG-CoA reductase 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1D6CHF7
Sequence length 296
Comment (tr|A0A1D6CHF7|A0A1D6CHF7_WHEAT) 3-hydroxy-3-methylglutaryl coenzyme A reductase {ECO:0000313|EnsemblPlants:TRIAE_CS42_7BS_TGACv1_592703_AA1943380.3} KW=Complete proteome; Reference proteome OX=4565 OS=Triticum aestivum (Wheat). GN= OC=Pooideae; Triticodae; Triticeae; Triticinae; Triticum.
Sequence
MTRAPVARFPTARRAAELKAFLEDPANFDTLSVVFNRSSRFGRLQGVQCAMAGRNLYMRF
SCSTGDAMGMNMISKGVQNVLDYLQDDFPDMDVISISGNFCSDKKPAAVNWIEGRGKSVV
CEAVIKEEIVKKVLKTNVQSLVELNVIKNLAGSAVAGALGGFNAHASNIVTAIFIATGQD
PAQNVESSQCITMLEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLDLLGVKGANR
ESPGSNARLLATVVAGGVLAGELSLLSALAAGQLVKSHMKYNRSSRDMSKAASLSS
Download sequence
Identical sequences A0A1D6CHF7
MLOC_64881.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]