SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D6CTJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D6CTJ0
Domain Number 1 Region: 71-132
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.88e-21
Family Skp1 dimerisation domain-like 0.00024
Further Details:      
 
Domain Number 2 Region: 2-42
Classification Level Classification E-value
Superfamily POZ domain 0.000000000549
Family BTB/POZ domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1D6CTJ0
Sequence length 132
Comment (tr|A0A1D6CTJ0|A0A1D6CTJ0_WHEAT) Uncharacterized protein {ECO:0000313|EnsemblPlants:TRIAE_CS42_7DL_TGACv1_604716_AA2000980.1} KW=Complete proteome; Reference proteome OX=4565 OS=Triticum aestivum (Wheat). GN= OC=Pooideae; Triticodae; Triticeae; Triticinae; Triticum.
Sequence
MESQMIRHMIEDGYTDNGLLLRNVNSKILSKVIEYCNKHVQAKATDISDFGGGARVSDAT
SAVPAALAEDLKNWDANFIKAANHLNIKGLLDLTCQTVADMMTGKTPEEIRKIFNINEKL
KPEEEEEIRREN
Download sequence
Identical sequences A0A1D6CTJ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]