SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D6GK55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D6GK55
Domain Number 1 Region: 21-81
Classification Level Classification E-value
Superfamily BEACH domain 0.00000000000000288
Family BEACH domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1D6GK55
Sequence length 117
Comment (tr|A0A1D6GK55|A0A1D6GK55_MAIZE) Uncharacterized protein {ECO:0000313|EMBL:AQK63727.1, ECO:0000313|EnsemblPlants:Zm00001d013503_P005} KW=Complete proteome; Reference proteome OX=4577 OS=Zea mays (Maize). GN=ZEAMMB73_Zm00001d013503 OC=Zea.
Sequence
MAPQPTHSRPCPTDDRWCRPLHACDHSTMGGKFDHVDRLFQSMESAYINSLSNTSDVKEL
IPEFFYMCEFPENSNSYHIGWGTYRRCCSPSMGKALTTLVRERQMLGIVVQSCVGKE
Download sequence
Identical sequences A0A1D6GK55

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]