SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D6J2K1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D6J2K1
Domain Number 1 Region: 74-144
Classification Level Classification E-value
Superfamily ERP29 C domain-like 5.1e-17
Family ERP29 C domain-like 0.0028
Further Details:      
 
Domain Number 2 Region: 19-60
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000524
Family PDI-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1D6J2K1
Sequence length 153
Comment (tr|A0A1D6J2K1|A0A1D6J2K1_MAIZE) Putative thioredoxin superfamily protein {ECO:0000313|EMBL:AQK42272.1} KW=Complete proteome; Reference proteome OX=4577 OS=Zea mays (Maize). GN=ZEAMMB73_Zm00001d024894 OC=Zea.
Sequence
MFVLSSMFTASLIIIYLCRYGVSGFPTLKFFPKRNKAGEDYDGGRDLDDFVKFINEKCGT
SRDPKGHLTSEARLVPSLNPLVKEFLNVVDDKRKEVLSKIEEDVAKLSGSAAKHGKIYVT
AAKKIMDKGSDYTKKETERLHRIIFELYYYLRS
Download sequence
Identical sequences A0A1D6J2K1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]