SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D6JRT2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D6JRT2
Domain Number 1 Region: 14-51
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.00000000000995
Family Steroid-binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1D6JRT2
Sequence length 56
Comment (tr|A0A1D6JRT2|A0A1D6JRT2_MAIZE) BTB/POZ domain-containing protein NPY2 {ECO:0000313|EMBL:ONL94634.1} KW=Complete proteome; Reference proteome OX=4577 OS=Zea mays (Maize). GN=ZEAMMB73_Zm00001d028075 OC=Zea.
Sequence
MEPTRSCPYYSRFWVFDVTKGRSHYGPGGGYHHFAGRDASRAFVSGNFTGKSASYC
Download sequence
Identical sequences A0A1D6JRT2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]