SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D8KC60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D8KC60
Domain Number 1 Region: 8-74
Classification Level Classification E-value
Superfamily N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.000000000000017
Family N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1D8KC60
Sequence length 187
Comment (tr|A0A1D8KC60|A0A1D8KC60_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:AOV18544.1} KW=Complete proteome OX=160660 OS=Acidihalobacter prosperus. GN=BJI67_09505 OC=Ectothiorhodospiraceae; Acidihalobacter.
Sequence
MTMMTQKEEQISALMDGQTSRFETRRSVDLLLSDTELRGRWERYHFIGDVLRRDVKRTAA
EGFSEAVMARIAAEQAAGVTPYRKQSRWAKPVLGFAMAASVAGAMVVGLQSMLGPGQIGT
DFAQQAVSGDTFGKMAAVEDVSDPGHHVPTQLESYMRMNSYMLSHAEQTGGQGMMPYVRM
VSYTPNR
Download sequence
Identical sequences A0A1D8KC60

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]