SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1D8NC10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D8NC10
Domain Number 1 Region: 2-253
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.62e-72
Family Capz beta-1 subunit 0.00000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1D8NC10
Sequence length 260
Comment (tr|A0A1D8NC10|A0A1D8NC10_YARLL) Uncharacterized protein {ECO:0000313|EMBL:AOW03168.1} KW=Complete proteome OX=4952 OS=Yarrowia lipolytica (Candida lipolytica). GN=YALI1_C28706g OC=Saccharomycetes; Saccharomycetales; Dipodascaceae; Yarrowia.
Sequence
MSDEQYDAALSLLRRLDPKNVSVNLNSLCKIAPELAEDLLSSVDQPLGVKTCKSTKKEYL
TCDYNRDGDSFRSPWSGDYEPATDGPTPSAALRKLEVLANDSFDIYRDLYYEGGVSSVYL
WDQGEGDNTNSFAGVVLLKKTSPSSSWDSIHVFEVETSRGEGIYRVTSTVILDLGSKSPK
LGLSGNLTRQTEREMAVDEPSQHIANLGSIVEDVESKLRNQLQEVYFGKARDIVGQVRSL
GGVEDAKQKQRQEEVIKGLQ
Download sequence
Identical sequences A0A1D8NC10 Q6CBA2
gnl|GLV|YALI0C20735g XP_502060.2.88470 4952.Q6CBA2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]