SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1E1FES2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E1FES2
Domain Number 1 Region: 1-32
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0000000549
Family Capz beta-1 subunit 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1E1FES2
Sequence length 43
Comment (tr|A0A1E1FES2|A0A1E1FES2_9HOMO) Cap2 protein {ECO:0000313|EMBL:BAV69005.1} OX=1712127 OS=Strobilomyces sp. L11-fb10. GN=Cap2 OC=Boletoideae; Strobilomyces.
Sequence
RELYYEGGVSSVYLWELEDGGFAGVVLLKKVMHPSSSDEPSGS
Download sequence
Identical sequences A0A1E1FES2 A0A1E1FES3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]