SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E1FET9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E1FET9
Domain Number 1 Region: 1-30
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0000000759
Family Capz beta-1 subunit 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1E1FET9
Sequence length 43
Comment (tr|A0A1E1FET9|A0A1E1FET9_9HOMO) Cap2 protein {ECO:0000313|EMBL:BAV69025.1} OX=1712140 OS=Strobilomyces aff. strobilaceus L22-ST29. GN=Cap2 OC=Boletoideae; Strobilomyces.
Sequence
RELYYEGGVSSVYLWELEDGGFAGVVLLKKVMGPSSPDEPSGS
Download sequence
Identical sequences A0A1E1FET9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]