SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1E1FEV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E1FEV6
Domain Number 1 Region: 1-33
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0000000445
Family Capz beta-1 subunit 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1E1FEV6
Sequence length 43
Comment (tr|A0A1E1FEV6|A0A1E1FEV6_9HOMO) Cap2 protein {ECO:0000313|EMBL:BAV69030.1} OX=182632 OS=Boletus reticulatus. GN=Cap2 OC=Boletoideae; Boletus.
Sequence
RELYYEGGVSSVYLWELEDGGFAGVVLLKKVMDPSSPDEPSGS
Download sequence
Identical sequences A0A1E1FET0 A0A1E1FET3 A0A1E1FET5 A0A1E1FET6 A0A1E1FEU0 A0A1E1FEU1 A0A1E1FEV1 A0A1E1FEV6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]