SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1E1FEW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E1FEW9
Domain Number 1 Region: 1-33
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.000000034
Family Capz beta-1 subunit 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1E1FEW9
Sequence length 43
Comment (tr|A0A1E1FEW9|A0A1E1FEW9_9HOMO) Cap2 protein {ECO:0000313|EMBL:BAV69009.1} OX=1712129 OS=Strobilomyces aff. foveatus L8-fr10. GN=Cap2 OC=Boletoideae; Strobilomyces.
Sequence
RELYYEGGVSSVYLWELDDGGFAGVVLLKKVMDPSSPDEPSGS
Download sequence
Identical sequences A0A1E1FEQ5 A0A1E1FEQ9 A0A1E1FER3 A0A1E1FES1 A0A1E1FES8 A0A1E1FEU5 A0A1E1FEU6 A0A1E1FEW9 A0A1E1FEY9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]