SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E1W9I6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E1W9I6
Domain Number 1 Region: 39-149
Classification Level Classification E-value
Superfamily BEACH domain 2.22e-36
Family BEACH domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1E1W9I6
Sequence length 150
Comment (tr|A0A1E1W9I6|A0A1E1W9I6_PECGO) Uncharacterized protein {ECO:0000313|EMBL:JAT83668.1} OX=13191 OS=Pectinophora gossypiella (Cotton pink bollworm). GN=g.3782 OC=Gelechioidea; Gelechiidae; Pexicopiinae; Pectinophora.
Sequence
ELFLSSGHAHLLAFDDVAERTAFLKALNACHLPGRMEPDTLTEAMTQWRNGQITNWEYLM
RLNSLAGRTYNDLMQYPVLPFILADYTSRILDLNEPKSFRDLSKPMAIQNKNREQHYINT
YNDLKAARREGCSPLLSRQPHHYASLYSNS
Download sequence
Identical sequences A0A1E1W9I6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]