SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E1WDC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E1WDC1
Domain Number 1 Region: 25-161
Classification Level Classification E-value
Superfamily PH domain-like 2.57e-41
Family Ran-binding domain 0.0000255
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1E1WDC1
Sequence length 222
Comment (tr|A0A1E1WDC1|A0A1E1WDC1_PECGO) Uncharacterized protein {ECO:0000313|EMBL:JAT84966.1} OX=13191 OS=Pectinophora gossypiella (Cotton pink bollworm). GN=g.13091 OC=Gelechioidea; Gelechiidae; Pexicopiinae; Pectinophora.
Sequence
MSSPTGESVRRNSETESVEGDAGEQDPQFEPVVSLPLVEMPTFEEDEEELVKIRARLYRY
DTGDHEWKERGTGDIKLLRHTVNNTVRVVMRRDKTLKVCANHFITPDIRMNVHCGSDKAF
NWSVFADYADETCKQELLAIKFGNAQNAVLWKTKFAEAQEIVRTKCSLYCQDQSSDDESS
ITRSEDTDTPEPRSTDKTEKEDNSDGVVLKLKELTVESEKPE
Download sequence
Identical sequences A0A1E1WDC1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]