SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1E1XS23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E1XS23
Domain Number 1 Region: 2-268
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.49e-96
Family Capz beta-1 subunit 0.000000002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1E1XS23
Sequence length 275
Comment (tr|A0A1E1XS23|A0A1E1XS23_9ACAR) Putative f-actin capping protein beta subunit {ECO:0000313|EMBL:JAU02121.1} OX=1581419 OS=Amblyomma sculptum. GN= OC=Amblyomma.
Sequence
TDQQLDSALDLMRRLPPQKIEKNLSDLIDLVPGLCEELLSSVDQPLKIATDKKCGKDYLL
CDYNRDGDSYRSPWSNNYEPPLEDGALPSERLRKLEVDANQAFDQYREMYFEGGVSSVYL
WDLDHGFAGVVLIKKGGDGSKKIMGSWDSIHVVEVQEKSSGRNAHYKLTSTAMLWLQTKK
PGSGTMNLGGSLTRQMEQDSAVSEAVPHIANIGKMVEDMENKIRTTLNEIYFGKTKDIVN
GLRSLQPLQDRKQQEALRNDLAQALRNRQQAKQDS
Download sequence
Identical sequences A0A1E1XS23

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]