SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E2V0G1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E2V0G1
Domain Number 1 Region: 64-115
Classification Level Classification E-value
Superfamily NosL/MerB-like 0.0000000000654
Family NosL-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1E2V0G1
Sequence length 181
Comment (tr|A0A1E2V0G1|A0A1E2V0G1_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:ODC00383.1} KW=Complete proteome; Reference proteome OX=1818881 OS=Candidatus Thiodiazotropha endoloripes. GN=A3197_08530 OC=sulfur-oxidizing symbionts; Candidatus Thiodiazotropha.
Sequence
MWFRGCKPICLSACLLMLVACSGDSGTGPKEVKWDRDACERCRMVVSDRYHAAQIRYFPP
DKKRSEVAMFDDIGCATLWLAKQPWEDDPKTEIWVTDHRTGDWIDARKATYVKGNLTPME
FGLGAQLETAPSGLSFEQAKQHIIQVEKRFDHHGVHLMERLKQQAKRRQGATGQPPTGAV
D
Download sequence
Identical sequences A0A1E2V0G1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]