SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1E3I4B1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E3I4B1
Domain Number 1 Region: 5-146,325-437
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.37e-59
Family Capz alpha-1 subunit 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1E3I4B1
Sequence length 437
Comment (tr|A0A1E3I4B1|A0A1E3I4B1_9TREE) Uncharacterized protein {ECO:0000313|EMBL:ODN83378.1} KW=Complete proteome; Reference proteome OX=1295533 OS=Cryptococcus amylolentus CBS 6039. GN=L202_01526 OC=Tremellomycetes; Tremellales; Cryptococcaceae; Cryptococcus.
Sequence
MSDITLEQKCKLASTLVEQTPPGEINDVINDIRAIIADDEALMPHVLPALRAYNLKQLHV
VEHPEEEGLPAHTSLLSEASIVPGAETERYIDAAGKRSFAFDHLTFTVSDYQPYQLPDDE
EQFRAELARSLTSYTKNHFPSGYASVSCSQIPLNPEPQPSEPTPAAAVPVESPKESSEPV
VKATEPSEIPEITPPADEASATVPPVTDVVPEQINAGDLEPAPTPAVGDVADVKKEELVE
PENLEKIDEIVEEEKEKEEGLGEAGESAEERPKVEGDEVPAAEEASPVVEEQGPAVAEES
AVAPEETPVKDVEEKLGSLSVEEKKQERVKNPVYTLEVVGNRYNPSNFWTGRWRTRWTVD
QAAGQVNGLINVDVHYYEQGNVQLATNHTASFPYPAEPKGTQSVASQIVTSISKIETLYH
LELNDVYAELGDKAFRA
Download sequence
Identical sequences A0A1E3I4B1
XP_018997378.1.6790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]