SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1E3J2J2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E3J2J2
Domain Number 1 Region: 4-298
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.96e-72
Family Capz beta-1 subunit 0.000000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1E3J2J2
Sequence length 304
Comment (tr|A0A1E3J2J2|A0A1E3J2J2_9TREE) Capping protein (Actin filament) muscle Z-line, beta {ECO:0000313|EMBL:ODN95059.1} KW=Complete proteome OX=1295532 OS=Cryptococcus depauperatus CBS 7855. GN=L204_04406 OC=Tremellomycetes; Tremellales; Cryptococcaceae; Cryptococcus.
Sequence
MADSDQTFDALLDLLRRLPPTQVQDNVNILCDLAPEYADDLLSNVDQPLKVLMDEEKGKE
FLGCDYNRDGDSFRSPWSNNYLPEPISGPAPSARLRQLEASLNAAFDTYREMYFEGGVSS
VYLWDLDDEPQGKEMSFAGVVLPQTNIPTFPLGSWDSLHVFECHERGRSAKYKLTSTVML
VMETKTLTKAEGKGQEDSEGTGGVTLSGNMTRQVRIDFSSLPAPKRLRLQAEIDYPLPTS
SSHISNVGRMVEDMEIKMRNLLSSVYFGKTEDVTNELRSQNGLEAKSKEDLLRAELAGKL
GGRK
Download sequence
Identical sequences A0A1E3J2J2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]